(data stored in ACNUC7421 zone)

EMBL: CP000948.YAJL

CP000948.YAJL        Location/Qualifiers
FT   CDS             complement(381606..382196)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yajL"
FT                   /locus_tag="ECDH10B_0380"
FT                   /product="conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECDH10B_0380"
FT                   /db_xref="EnsemblGenomes-Tr:ACB01552"
FT                   /protein_id="ACB01552.1"
FT                   /translation="MSASALVCLAPGSEETEAVTTIDLLVRGGIKVTTASVASDGNLAI
FT                   TCSRGVKLLADAPLVEVADGEYDVIVLPGGIKGAECFRDSTLLVETVKQFHRSGRIVAA
FT                   ICAAPATVLVPHDIFPIGNMTGFPTLKDKIPAEQWLDKRVVWDARVKLLTSQGPGTAID
FT                   FGLKIIDLLVGREKAHEVASQLVMAAGIYNYYE"
     MSASALVCLA PGSEETEAVT TIDLLVRGGI KVTTASVASD GNLAITCSRG VKLLADAPLV        60
     EVADGEYDVI VLPGGIKGAE CFRDSTLLVE TVKQFHRSGR IVAAICAAPA TVLVPHDIFP       120
     IGNMTGFPTL KDKIPAEQWL DKRVVWDARV KLLTSQGPGT AIDFGLKIID LLVGREKAHE       180
     VASQLVMAAG IYNYYE                                                       196
//

If you have problems or comments...

PBIL Back to PBIL home page