(data stored in ACNUC7421 zone)

EMBL: CP000948.YBAJ

CP000948.YBAJ        Location/Qualifiers
FT   CDS             complement(418889..419263)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybaJ"
FT                   /locus_tag="ECDH10B_0417"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECDH10B_0417"
FT                   /db_xref="EnsemblGenomes-Tr:ACB01588"
FT                   /protein_id="ACB01588.1"
FT                   /translation="MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAIN
FT                   LQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYLDDTFMLFSSYGINMQDLQKWRKSG
FT                   NRLFRCFVNATKENPASLSC"
     MDEYSPKRHD IAQLKFLCET LYHDCLANLE ESNHGWVNDP TSAINLQLNE LIEHIATFAL        60
     NYKIKYNEDN KLIEQIDEYL DDTFMLFSSY GINMQDLQKW RKSGNRLFRC FVNATKENPA       120
     SLSC                                                                    124
//

If you have problems or comments...

PBIL Back to PBIL home page