(data stored in ACNUC7421 zone)

EMBL: CP000948.YBAM

CP000948.YBAM        Location/Qualifiers
FT   CDS             complement(428665..428826)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybaM"
FT                   /locus_tag="ECDH10B_0422"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECDH10B_0422"
FT                   /db_xref="EnsemblGenomes-Tr:ACB01593"
FT                   /protein_id="ACB01593.1"
FT                   /translation="MSLENAPDDVKLAVDLIVLLEENQIPASTVLRALDIVKRDYEKKL
FT                   TRDDEAEK"
     MSLENAPDDV KLAVDLIVLL EENQIPASTV LRALDIVKRD YEKKLTRDDE AEK               53
//

If you have problems or comments...

PBIL Back to PBIL home page