(data stored in ACNUC7421 zone)

EMBL: CP000948.YBAV

CP000948.YBAV        Location/Qualifiers
FT   CDS             402492..402863
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybaV"
FT                   /locus_tag="ECDH10B_0398"
FT                   /product="conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECDH10B_0398"
FT                   /db_xref="EnsemblGenomes-Tr:ACB01570"
FT                   /protein_id="ACB01570.1"
FT                   /translation="MKHGIKALLITLSLACAGMSHSALAAASVAKPTAVETKAEAPAAQ
FT                   SKAAVPAKASDEEGTRVSINNASAEELARAMNGVGLKKAQAIVSYREEYGPFKTVEDLK
FT                   QVPGMGNSLVERNLAVLTL"
     MKHGIKALLI TLSLACAGMS HSALAAASVA KPTAVETKAE APAAQSKAAV PAKASDEEGT        60
     RVSINNASAE ELARAMNGVG LKKAQAIVSY REEYGPFKTV EDLKQVPGMG NSLVERNLAV       120
     LTL                                                                     123
//

If you have problems or comments...

PBIL Back to PBIL home page