(data stored in ACNUC7421 zone)

EMBL: CP000948.YBAW

CP000948.YBAW        Location/Qualifiers
FT   CDS             402957..403355
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybaW"
FT                   /locus_tag="ECDH10B_0399"
FT                   /product="conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECDH10B_0399"
FT                   /db_xref="EnsemblGenomes-Tr:ACB01571"
FT                   /protein_id="ACB01571.1"
FT                   /translation="MQTQIKVRGYHLDVYQHVNNARYLEFLEEARWDGLENSDSFQWMT
FT                   AHNIAFVVVNININYRRPAVLSDLLTITSQLQQLNGKSGILSQVITLEPEGQVVADALI
FT                   TFVCIDLKTQKALALEGELREKLEQMVK"
     MQTQIKVRGY HLDVYQHVNN ARYLEFLEEA RWDGLENSDS FQWMTAHNIA FVVVNININY        60
     RRPAVLSDLL TITSQLQQLN GKSGILSQVI TLEPEGQVVA DALITFVCID LKTQKALALE       120
     GELREKLEQM VK                                                           132
//

If you have problems or comments...

PBIL Back to PBIL home page