(data stored in ACNUC7421 zone)

EMBL: CP000948.YBBA

CP000948.YBBA        Location/Qualifiers
FT   CDS             458288..458974
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybbA"
FT                   /locus_tag="ECDH10B_0452"
FT                   /product="predicted transporter subunit: ATP-binding
FT                   component of ABC superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:ECDH10B_0452"
FT                   /db_xref="EnsemblGenomes-Tr:ACB01622"
FT                   /protein_id="ACB01622.1"
FT                   /translation="MPAENIVEVHHLKKSVGQGEHELSILTGVELVVKRGETIALVGES
FT                   GSGKSTLLAILAGLDDGSSGEVSLVGQPLHNMDEEARAKLRAKHVGFVFQSFMLIPTLN
FT                   ALENVELPALLRGESSAESRNGAKALLEQLGLGKRLDHLPAQLSGGEQQRVALARAFNG
FT                   RPDVLFADEPTGNLDRQTGDKIADLLFSLNREHGTTLIMVTHDLQLAARCDRCLRLVNG
FT                   QLQEEA"
     MPAENIVEVH HLKKSVGQGE HELSILTGVE LVVKRGETIA LVGESGSGKS TLLAILAGLD        60
     DGSSGEVSLV GQPLHNMDEE ARAKLRAKHV GFVFQSFMLI PTLNALENVE LPALLRGESS       120
     AESRNGAKAL LEQLGLGKRL DHLPAQLSGG EQQRVALARA FNGRPDVLFA DEPTGNLDRQ       180
     TGDKIADLLF SLNREHGTTL IMVTHDLQLA ARCDRCLRLV NGQLQEEA                    228
//

If you have problems or comments...

PBIL Back to PBIL home page