(data stored in ACNUC7421 zone)

EMBL: CP000948.YBBC

CP000948.YBBC        Location/Qualifiers
FT   CDS             466136..466504
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybbC"
FT                   /locus_tag="ECDH10B_0455"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECDH10B_0455"
FT                   /db_xref="EnsemblGenomes-Tr:ACB01625"
FT                   /protein_id="ACB01625.1"
FT                   /translation="MKYSSIFSMLSFFILFACNETAVYGSDENIIFMRYVEKLHLDKYS
FT                   VKNTVKTETMAIQLAEIYVRYRYGERIAEEEKPYLITELPDSWVVEGAKLPYEVAGGVF
FT                   IIEINKKNGCVLNFLHSK"
     MKYSSIFSML SFFILFACNE TAVYGSDENI IFMRYVEKLH LDKYSVKNTV KTETMAIQLA        60
     EIYVRYRYGE RIAEEEKPYL ITELPDSWVV EGAKLPYEVA GGVFIIEINK KNGCVLNFLH       120
     SK                                                                      122
//

If you have problems or comments...

PBIL Back to PBIL home page