(data stored in ACNUC7421 zone)

EMBL: CP000948.YBBJ

CP000948.YBBJ        Location/Qualifiers
FT   CDS             complement(452956..453411)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybbJ"
FT                   /locus_tag="ECDH10B_0445"
FT                   /product="conserved inner membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECDH10B_0445"
FT                   /db_xref="EnsemblGenomes-Tr:ACB01615"
FT                   /protein_id="ACB01615.1"
FT                   /translation="MELMVVHPHIFWLSLGGLLLAAEMLGGNGYLLWSGVAAVITGLVV
FT                   WLVPLGWEWQGVMFAILTLLAAWLWWKWLSRRVREQKHSDSHLNQRGQQLIGRRFVLES
FT                   PLVNGRGHMRVGDSSWPVSASEDLGAGTHVEVIAIEGITLHIRAVSS"
     MELMVVHPHI FWLSLGGLLL AAEMLGGNGY LLWSGVAAVI TGLVVWLVPL GWEWQGVMFA        60
     ILTLLAAWLW WKWLSRRVRE QKHSDSHLNQ RGQQLIGRRF VLESPLVNGR GHMRVGDSSW       120
     PVSASEDLGA GTHVEVIAIE GITLHIRAVS S                                      151
//

If you have problems or comments...

PBIL Back to PBIL home page