(data stored in ACNUC7421 zone)

EMBL: CP000948.YBBL

CP000948.YBBL        Location/Qualifiers
FT   CDS             454474..455151
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybbL"
FT                   /locus_tag="ECDH10B_0447"
FT                   /product="predicted transporter subunit: ATP-binding
FT                   component of ABC superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:ECDH10B_0447"
FT                   /db_xref="EnsemblGenomes-Tr:ACB01617"
FT                   /protein_id="ACB01617.1"
FT                   /translation="MQENSPLLQLQNVGYLAGDAKILNNINFSLRAGEFKLITGPSGCG
FT                   KSTLLKIVASLISPTSGTLLFEGEDVSTLKPEIYRQQVSYCAQTPTLFGDTVYDNLIFP
FT                   WQIRNRQPDPAIFLDFLERFALPDSILTKNIAELSGGEKQRISLIRNLQFMPKVLLLDE
FT                   ITSALDESNKHNVNEMIHRYVREQNIAVLWVTHDKDEINHADKVITLQPHAGEMQEARY
FT                   ELA"
     MQENSPLLQL QNVGYLAGDA KILNNINFSL RAGEFKLITG PSGCGKSTLL KIVASLISPT        60
     SGTLLFEGED VSTLKPEIYR QQVSYCAQTP TLFGDTVYDN LIFPWQIRNR QPDPAIFLDF       120
     LERFALPDSI LTKNIAELSG GEKQRISLIR NLQFMPKVLL LDEITSALDE SNKHNVNEMI       180
     HRYVREQNIA VLWVTHDKDE INHADKVITL QPHAGEMQEA RYELA                       225
//

If you have problems or comments...

PBIL Back to PBIL home page