(data stored in ACNUC7421 zone)

EMBL: CP000948.YBBO

CP000948.YBBO        Location/Qualifiers
FT   CDS             complement(456895..457704)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybbO"
FT                   /locus_tag="ECDH10B_0450"
FT                   /product="predicted oxidoreductase with NAD(P)-binding
FT                   Rossmann-fold domain"
FT                   /db_xref="EnsemblGenomes-Gn:ECDH10B_0450"
FT                   /db_xref="EnsemblGenomes-Tr:ACB01620"
FT                   /protein_id="ACB01620.1"
FT                   /translation="MTHKATEILTGKVMQKSVLITGCSSGIGLESALELKRQGFHVLAG
FT                   CRKPDDVERMNSMGFTGVLIDLDSPESVDRAADEVIALTDNCLYGIFNNAGFGMYGPLS
FT                   TISRAQMEQQFSANFFGAHQLTMRLLPAMLPHGEGRIVMTSSVMGLISTPGRGAYAASK
FT                   YALEAWSDALRMELRHSGIKVSLIEPGPIRTRFTDNVNQTQSDKPVENPGIAARFTLGP
FT                   EAVVDKVRHAFISEKPKMRYPVTLVTWAVMVLKRLLPGRVMDKILQG"
     MTHKATEILT GKVMQKSVLI TGCSSGIGLE SALELKRQGF HVLAGCRKPD DVERMNSMGF        60
     TGVLIDLDSP ESVDRAADEV IALTDNCLYG IFNNAGFGMY GPLSTISRAQ MEQQFSANFF       120
     GAHQLTMRLL PAMLPHGEGR IVMTSSVMGL ISTPGRGAYA ASKYALEAWS DALRMELRHS       180
     GIKVSLIEPG PIRTRFTDNV NQTQSDKPVE NPGIAARFTL GPEAVVDKVR HAFISEKPKM       240
     RYPVTLVTWA VMVLKRLLPG RVMDKILQG                                         269
//

If you have problems or comments...

PBIL Back to PBIL home page