(data stored in ACNUC7421 zone)

EMBL: CP000948.YBBV

CP000948.YBBV        Location/Qualifiers
FT   CDS             476051..476329
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybbV"
FT                   /locus_tag="ECDH10B_0466"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECDH10B_0466"
FT                   /db_xref="EnsemblGenomes-Tr:ACB01635"
FT                   /protein_id="ACB01635.1"
FT                   /translation="MNRPAILKKKAAKDVASVLKIIFLFYLFLIARLKQRYSIREIKRD
FT                   LWNIRENYSSNAAIAKIYCRKRKASGPGKHLTILPYGWVRFITFPIM"
     MNRPAILKKK AAKDVASVLK IIFLFYLFLI ARLKQRYSIR EIKRDLWNIR ENYSSNAAIA        60
     KIYCRKRKAS GPGKHLTILP YGWVRFITFP IM                                      92
//

If you have problems or comments...

PBIL Back to PBIL home page