(data stored in ACNUC7421 zone)

EMBL: CP000948.YBCF

CP000948.YBCF        Location/Qualifiers
FT   CDS             488994..489887
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybcF"
FT                   /locus_tag="ECDH10B_0477"
FT                   /product="predicted carbamate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:ECDH10B_0477"
FT                   /db_xref="EnsemblGenomes-Tr:ACB01646"
FT                   /protein_id="ACB01646.1"
FT                   /translation="MKTLVVALGGNALLQRGEALTAENQYRNIASAVPALARLARSYRL
FT                   AIVHGNGPQVGLLALQNLAWKEVEPYPLDVLVAESQGMIGYMLAQSLSAQPQMPPVTTV
FT                   LTRIEVSPDDPAFLQPEKFIGPVYQPEEQEALEAAYGWQMKRDGKYLRRVVASPQPRKI
FT                   LDSEAIELLLKEGHVVICSGGGGVPVTDDGAGSEAVIDKDLAAALLAEQINADGLVILT
FT                   DADAVYENWGTPQQRAIRHATPDELAPFAKADGSMGPNVTAVSGYVRSRGKPAWIGALS
FT                   RIEETLAGEAGTCISL"
     MKTLVVALGG NALLQRGEAL TAENQYRNIA SAVPALARLA RSYRLAIVHG NGPQVGLLAL        60
     QNLAWKEVEP YPLDVLVAES QGMIGYMLAQ SLSAQPQMPP VTTVLTRIEV SPDDPAFLQP       120
     EKFIGPVYQP EEQEALEAAY GWQMKRDGKY LRRVVASPQP RKILDSEAIE LLLKEGHVVI       180
     CSGGGGVPVT DDGAGSEAVI DKDLAAALLA EQINADGLVI LTDADAVYEN WGTPQQRAIR       240
     HATPDELAPF AKADGSMGPN VTAVSGYVRS RGKPAWIGAL SRIEETLAGE AGTCISL          297
//

If you have problems or comments...

PBIL Back to PBIL home page