(data stored in ACNUC7421 zone)

EMBL: CP000948.YBCI

CP000948.YBCI        Location/Qualifiers
FT   CDS             complement(494587..495108)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybcI"
FT                   /locus_tag="ECDH10B_0483"
FT                   /product="conserved inner membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECDH10B_0483"
FT                   /db_xref="EnsemblGenomes-Tr:ACB01652"
FT                   /protein_id="ACB01652.1"
FT                   /translation="MPTVITHAAVPLCIGLGLGSKVIPPRLLFAGIILAMLPDADVLSF
FT                   KFGVAYGNVFGHRGFTHSLVFAFVVPLLCVFIGRRWFRAGLIRCWLFLTVSLLSHSLLD
FT                   SVTTGGKGVGWLWPWSDERFFAPWQVIKVAPFALSRYTTPYGHQVIISELMWVWLPGML
FT                   LMGMLWWRRR"
     MPTVITHAAV PLCIGLGLGS KVIPPRLLFA GIILAMLPDA DVLSFKFGVA YGNVFGHRGF        60
     THSLVFAFVV PLLCVFIGRR WFRAGLIRCW LFLTVSLLSH SLLDSVTTGG KGVGWLWPWS       120
     DERFFAPWQV IKVAPFALSR YTTPYGHQVI ISELMWVWLP GMLLMGMLWW RRR              173
//

If you have problems or comments...

PBIL Back to PBIL home page