(data stored in ACNUC7421 zone)

EMBL: CP000948.YBCJ

CP000948.YBCJ        Location/Qualifiers
FT   CDS             complement(495216..495428)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybcJ"
FT                   /locus_tag="ECDH10B_0484"
FT                   /product="predicted RNA-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECDH10B_0484"
FT                   /db_xref="EnsemblGenomes-Tr:ACB01653"
FT                   /protein_id="ACB01653.1"
FT                   /translation="MATFSLGKHPHVELCDLLKLEGWSESGAQAKIAIAEGQVKVDGAV
FT                   ETRKRCKIVAGQTVSFAGHSVQVVA"
     MATFSLGKHP HVELCDLLKL EGWSESGAQA KIAIAEGQVK VDGAVETRKR CKIVAGQTVS        60
     FAGHSVQVVA                                                               70
//

If you have problems or comments...

PBIL Back to PBIL home page