(data stored in ACNUC7421 zone)

EMBL: CP000948.YBCL

CP000948.YBCL        Location/Qualifiers
FT   CDS             509448..509999
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybcL"
FT                   /locus_tag="ECDH10B_0501"
FT                   /product="DLP12 prophage; predicted kinase inhibitor"
FT                   /db_xref="EnsemblGenomes-Gn:ECDH10B_0501"
FT                   /db_xref="EnsemblGenomes-Tr:ACB01668"
FT                   /protein_id="ACB01668.1"
FT                   /translation="MKTLIVSTVLAFITFSAQAAAFQVTSNEIKTGEQLTTSHVFSGFG
FT                   CEGGNTSPSLTWSGVPEGTKSFAVTVYDPDAPTGSGWWHWTVVNIPATVTYLPVDAGRR
FT                   DGTKLPTGAVQGRNDFGYAGFGGACPPKGDKPHHYQFKVWALKTEKIPVDSNSSGALVG
FT                   YMLNANKIATAEITPVYEIK"
     MKTLIVSTVL AFITFSAQAA AFQVTSNEIK TGEQLTTSHV FSGFGCEGGN TSPSLTWSGV        60
     PEGTKSFAVT VYDPDAPTGS GWWHWTVVNI PATVTYLPVD AGRRDGTKLP TGAVQGRNDF       120
     GYAGFGGACP PKGDKPHHYQ FKVWALKTEK IPVDSNSSGA LVGYMLNANK IATAEITPVY       180
     EIK                                                                     183
//

If you have problems or comments...

PBIL Back to PBIL home page