(data stored in ACNUC7421 zone)

EMBL: CP000948.YBCN

CP000948.YBCN        Location/Qualifiers
FT   CDS             511021..511476
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybcN"
FT                   /locus_tag="ECDH10B_0503"
FT                   /product="DLP12 prophage; predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECDH10B_0503"
FT                   /db_xref="EnsemblGenomes-Tr:ACB01670"
FT                   /protein_id="ACB01670.1"
FT                   /translation="MNLSQDGIKLHRGNFTAIGRQIQPYLEEGKCFRMVLKPWREKRSL
FT                   SQNALSHMWYSEISEYLISRGKTFATPAWVKDALKHTYLGYETKDLVDVVTGDITTIQS
FT                   LRHTSDLDTGEMYVFLCKVEAWAMNIGCHLTIPQSCEFQLLRDKQEA"
     MNLSQDGIKL HRGNFTAIGR QIQPYLEEGK CFRMVLKPWR EKRSLSQNAL SHMWYSEISE        60
     YLISRGKTFA TPAWVKDALK HTYLGYETKD LVDVVTGDIT TIQSLRHTSD LDTGEMYVFL       120
     CKVEAWAMNI GCHLTIPQSC EFQLLRDKQE A                                      151
//

If you have problems or comments...

PBIL Back to PBIL home page