(data stored in ACNUC7421 zone)

EMBL: CP000948.YBCO

CP000948.YBCO        Location/Qualifiers
FT   CDS             511639..511929
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybcO"
FT                   /locus_tag="ECDH10B_0505"
FT                   /product="DLP12 prophage; predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECDH10B_0505"
FT                   /db_xref="EnsemblGenomes-Tr:ACB01672"
FT                   /protein_id="ACB01672.1"
FT                   /translation="MADLRKAARGRECQVRIPGVCNGNPETSVLAHIRLTGLCGTGTKP
FT                   PDLIATIACSACHDEIDRRTHFVDAGYAKECALEGMARTQVIWLKEGVIKA"
     MADLRKAARG RECQVRIPGV CNGNPETSVL AHIRLTGLCG TGTKPPDLIA TIACSACHDE        60
     IDRRTHFVDA GYAKECALEG MARTQVIWLK EGVIKA                                  96
//

If you have problems or comments...

PBIL Back to PBIL home page