(data stored in ACNUC7421 zone)

EMBL: CP000948.YBCQ

CP000948.YBCQ        Location/Qualifiers
FT   CDS             512511..512894
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybcQ"
FT                   /locus_tag="ECDH10B_0508"
FT                   /product="DLP12 prophage; predicted antitermination
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECDH10B_0508"
FT                   /db_xref="EnsemblGenomes-Tr:ACB01675"
FT                   /protein_id="ACB01675.1"
FT                   /translation="MRDIQMVLERWGAWAANNHEDVTWSSIAAGFKGLITSKVKSRPQC
FT                   CDDDAMIICGCMARLKKNNSDLHDLLVDYYVVGMTFMSLAGKHCCSDGYIGKRLQKAEG
FT                   IIEGMLMALDIRLEMDIVVNNSN"
     MRDIQMVLER WGAWAANNHE DVTWSSIAAG FKGLITSKVK SRPQCCDDDA MIICGCMARL        60
     KKNNSDLHDL LVDYYVVGMT FMSLAGKHCC SDGYIGKRLQ KAEGIIEGML MALDIRLEMD       120
     IVVNNSN                                                                 127
//

If you have problems or comments...

PBIL Back to PBIL home page