(data stored in ACNUC7421 zone)

EMBL: CP000948.YBDB

CP000948.YBDB        Location/Qualifiers
FT   CDS             567855..568268
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybdB"
FT                   /locus_tag="ECDH10B_0557"
FT                   /product="conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECDH10B_0557"
FT                   /db_xref="EnsemblGenomes-Tr:ACB01720"
FT                   /protein_id="ACB01720.1"
FT                   /translation="MIWKRHLTLDELNATSDNTMVAHLGIVYTRLGDDVLEAEMPVDTR
FT                   THQPFGLLHGGASAALAETLGSMAGFMMTRDGQCVVGTELNATHHRPVSEGKVRGVCQP
FT                   LHLGRQNQSWEIVVFDEQGRRCCTCRLGTAVLG"
     MIWKRHLTLD ELNATSDNTM VAHLGIVYTR LGDDVLEAEM PVDTRTHQPF GLLHGGASAA        60
     LAETLGSMAG FMMTRDGQCV VGTELNATHH RPVSEGKVRG VCQPLHLGRQ NQSWEIVVFD       120
     EQGRRCCTCR LGTAVLG                                                      137
//

If you have problems or comments...

PBIL Back to PBIL home page