(data stored in ACNUC7421 zone)

EMBL: CP000948.YBDJ

CP000948.YBDJ        Location/Qualifiers
FT   CDS             complement(544506..544754)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybdJ"
FT                   /locus_tag="ECDH10B_0538"
FT                   /product="predicted inner membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECDH10B_0538"
FT                   /db_xref="EnsemblGenomes-Tr:ACB01701"
FT                   /protein_id="ACB01701.1"
FT                   /translation="MKHPLETLTTAAGILLMAFLSCLLLPAPALGLALAQKLVTMFHLM
FT                   DLSQLYTLLFCLWFLVLGAIEYFVLRFIWRRWFSLAD"
     MKHPLETLTT AAGILLMAFL SCLLLPAPAL GLALAQKLVT MFHLMDLSQL YTLLFCLWFL        60
     VLGAIEYFVL RFIWRRWFSL AD                                                 82
//

If you have problems or comments...

PBIL Back to PBIL home page