(data stored in ACNUC7421 zone)

EMBL: CP000948.YBDN

CP000948.YBDN        Location/Qualifiers
FT   CDS             complement(573904..575124)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybdN"
FT                   /locus_tag="ECDH10B_0563"
FT                   /product="conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECDH10B_0563"
FT                   /db_xref="EnsemblGenomes-Tr:ACB01726"
FT                   /protein_id="ACB01726.1"
FT                   /translation="MSIYKIPLPLNILEAARERITWTLNTLPRVCVSFSGGKDSGLMLH
FT                   LTAELARQMGKKICVLFIDWEAQFSCTINYVQSLRELYTDVIEEFYWVALPLTTQNSLS
FT                   QYQPEWQCWEPDVEWVRQPPQDAITDPDFFCFYQPGMTFEQFVREFAEWFSQKRPAAMM
FT                   IGIRADESYNRFVAIASLNKQRFADDKPWTTAAPGGHSWYIYPIYDWKVADIWTWYANH
FT                   QSLCNPLYNLMYQAGVPLRHMRICEPFGPEQRQGLWLYHVIEPDRWAAMCARVSGVKSG
FT                   GIYAGHDNHFYGHRKILKPEHLDWQEYALLLLNSMPEKTAEHYRNKIAIYLHWYQKKGI
FT                   EVPQTQQGDIGAKDIPSWRRICKVLLNNDYWCRALSFSPTKSKNYQRYNERIKGKRQEW
FT                   GILCNND"
     MSIYKIPLPL NILEAARERI TWTLNTLPRV CVSFSGGKDS GLMLHLTAEL ARQMGKKICV        60
     LFIDWEAQFS CTINYVQSLR ELYTDVIEEF YWVALPLTTQ NSLSQYQPEW QCWEPDVEWV       120
     RQPPQDAITD PDFFCFYQPG MTFEQFVREF AEWFSQKRPA AMMIGIRADE SYNRFVAIAS       180
     LNKQRFADDK PWTTAAPGGH SWYIYPIYDW KVADIWTWYA NHQSLCNPLY NLMYQAGVPL       240
     RHMRICEPFG PEQRQGLWLY HVIEPDRWAA MCARVSGVKS GGIYAGHDNH FYGHRKILKP       300
     EHLDWQEYAL LLLNSMPEKT AEHYRNKIAI YLHWYQKKGI EVPQTQQGDI GAKDIPSWRR       360
     ICKVLLNNDY WCRALSFSPT KSKNYQRYNE RIKGKRQEWG ILCNND                      406
//

If you have problems or comments...

PBIL Back to PBIL home page