(data stored in ACNUC7421 zone)

EMBL: CP000948.YBEA

CP000948.YBEA        Location/Qualifiers
FT   CDS             complement(606803..607270)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybeA"
FT                   /locus_tag="ECDH10B_0597"
FT                   /product="conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECDH10B_0597"
FT                   /db_xref="EnsemblGenomes-Tr:ACB01757"
FT                   /db_xref="GOA:B1X631"
FT                   /db_xref="InterPro:IPR003742"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="UniProtKB/Swiss-Prot:B1X631"
FT                   /protein_id="ACB01757.1"
FT                   /translation="MKLQLVAVGTKMPDWVQTGFTEYLRRFPKDMPFELIEIPAGKRGK
FT                   NADIKRILDKEGEQMLAAAGKNRIVTLDIPGKPWDTPQLAAELERWKLDGRDVSLLIGG
FT                   PEGLSPACKAAAEQSWSLSALTLPHPLVRVLVAESLYRAWSITTNHPYHRE"
     MKLQLVAVGT KMPDWVQTGF TEYLRRFPKD MPFELIEIPA GKRGKNADIK RILDKEGEQM        60
     LAAAGKNRIV TLDIPGKPWD TPQLAAELER WKLDGRDVSL LIGGPEGLSP ACKAAAEQSW       120
     SLSALTLPHP LVRVLVAESL YRAWSITTNH PYHRE                                  155
//

If you have problems or comments...

PBIL Back to PBIL home page