(data stored in ACNUC7421 zone)

EMBL: CP000948.YBEB

CP000948.YBEB        Location/Qualifiers
FT   CDS             complement(607274..607591)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybeB"
FT                   /locus_tag="ECDH10B_0598"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECDH10B_0598"
FT                   /db_xref="EnsemblGenomes-Tr:ACB01758"
FT                   /protein_id="ACB01758.1"
FT                   /translation="MQGKALQDFVIDKIDDLKGQDIIALDVQGKSSITDCMIICTGTSS
FT                   RHVMSIADHVVQESRAAGLLPLGVEGENSADWIVVDLGDVIVHVMQEESRRLYELEKLW
FT                   S"
     MQGKALQDFV IDKIDDLKGQ DIIALDVQGK SSITDCMIIC TGTSSRHVMS IADHVVQESR        60
     AAGLLPLGVE GENSADWIVV DLGDVIVHVM QEESRRLYEL EKLWS                       105
//

If you have problems or comments...

PBIL Back to PBIL home page