(data stored in ACNUC7421 zone)

EMBL: CP000948.YBED

CP000948.YBED        Location/Qualifiers
FT   CDS             complement(600934..601197)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybeD"
FT                   /locus_tag="ECDH10B_0592"
FT                   /product="conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECDH10B_0592"
FT                   /db_xref="EnsemblGenomes-Tr:ACB01752"
FT                   /protein_id="ACB01752.1"
FT                   /translation="MKTKLNELLEFPTPFTYKVMGQALPELVDQVVEVVQRHAPGDYTP
FT                   TVKPSSKGNYHSVSITINATHIEQVETLYEELGKIDIVRMVL"
     MKTKLNELLE FPTPFTYKVM GQALPELVDQ VVEVVQRHAP GDYTPTVKPS SKGNYHSVSI        60
     TINATHIEQV ETLYEELGKI DIVRMVL                                            87
//

If you have problems or comments...

PBIL Back to PBIL home page