(data stored in ACNUC7421 zone)

EMBL: CP000948.YBEQ

CP000948.YBEQ        Location/Qualifiers
FT   CDS             complement(614125..615102)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybeQ"
FT                   /locus_tag="ECDH10B_0605"
FT                   /product="conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECDH10B_0605"
FT                   /db_xref="EnsemblGenomes-Tr:ACB01765"
FT                   /protein_id="ACB01765.1"
FT                   /translation="MIFTSSCCDNLSIDEIIERAEKGDCEAQYIVGFYYNRDSAIDSPD
FT                   DEKAFYWLKLAAEQGHCEAQYSLGQKYTEDKSRHKDNEQAIFWLKKAALQGHTFASNAL
FT                   GWTLDRGEAPNYKEAVVWYQIAAESGMSYAQNNLGWMYRNGNGVAKDYALAFFWYKQAA
FT                   LQGHSDAQNNLADLYEDGKGVAQNKTLAAFWYLKSAQQGNRHAQFQIAWDYNAGEGVDQ
FT                   DYKQAMYWYLKAAAQGSVGAYVNIGYMYKHGQGVEKDYQAAFEWFTKAAECNDATAWYN
FT                   LAIMYHYGEGRPVDLRQALDLYRKVQSSGTRDVSQEIRETEDLL"
     MIFTSSCCDN LSIDEIIERA EKGDCEAQYI VGFYYNRDSA IDSPDDEKAF YWLKLAAEQG        60
     HCEAQYSLGQ KYTEDKSRHK DNEQAIFWLK KAALQGHTFA SNALGWTLDR GEAPNYKEAV       120
     VWYQIAAESG MSYAQNNLGW MYRNGNGVAK DYALAFFWYK QAALQGHSDA QNNLADLYED       180
     GKGVAQNKTL AAFWYLKSAQ QGNRHAQFQI AWDYNAGEGV DQDYKQAMYW YLKAAAQGSV       240
     GAYVNIGYMY KHGQGVEKDY QAAFEWFTKA AECNDATAWY NLAIMYHYGE GRPVDLRQAL       300
     DLYRKVQSSG TRDVSQEIRE TEDLL                                             325
//

If you have problems or comments...

PBIL Back to PBIL home page