(data stored in ACNUC7421 zone)

EMBL: CP000948.YBER

CP000948.YBER        Location/Qualifiers
FT   CDS             615266..615973
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybeR"
FT                   /locus_tag="ECDH10B_0606"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECDH10B_0606"
FT                   /db_xref="EnsemblGenomes-Tr:ACB01766"
FT                   /protein_id="ACB01766.1"
FT                   /translation="MDMESQKILFALSTPMEIRNECCLPSHSSPKMYLGTCFFDLSSSW
FT                   GIDDRDDLLRTIHRMIDNGHAARLAGFYHRWFRYSPCEWRDYLAELNEQGQAYAQFVAS
FT                   TAECCGEGGIKAWDYVRMGFLSRMGVLNNWLSEEESLWIQSRIHLRALRYYSNWRQYFA
FT                   GYTFGRQYWQSPEDDHLPLLREFLARKEYDDSGNDMFYQLFASDDAYYPTLSWQPLAYY
FT                   SACPETLKDMSDL"
     MDMESQKILF ALSTPMEIRN ECCLPSHSSP KMYLGTCFFD LSSSWGIDDR DDLLRTIHRM        60
     IDNGHAARLA GFYHRWFRYS PCEWRDYLAE LNEQGQAYAQ FVASTAECCG EGGIKAWDYV       120
     RMGFLSRMGV LNNWLSEEES LWIQSRIHLR ALRYYSNWRQ YFAGYTFGRQ YWQSPEDDHL       180
     PLLREFLARK EYDDSGNDMF YQLFASDDAY YPTLSWQPLA YYSACPETLK DMSDL            235
//

If you have problems or comments...

PBIL Back to PBIL home page