(data stored in ACNUC7421 zone)

EMBL: CP000948.YBEY

CP000948.YBEY        Location/Qualifiers
FT   CDS             complement(743689..744156)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybeY"
FT                   /locus_tag="ECDH10B_0728"
FT                   /product="conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECDH10B_0728"
FT                   /db_xref="EnsemblGenomes-Tr:ACB01881"
FT                   /db_xref="GOA:B1X654"
FT                   /db_xref="InterPro:IPR002036"
FT                   /db_xref="InterPro:IPR020549"
FT                   /db_xref="InterPro:IPR023091"
FT                   /db_xref="UniProtKB/Swiss-Prot:B1X654"
FT                   /protein_id="ACB01881.1"
FT                   /translation="MSQVILDLQLACEDNSGLPEESQFQTWLNAVIPQFQEESEVTIRV
FT                   VDTAESHSLNLTYRGKDKPTNVLSFPFEVPPGMEMSLLGDLVICRQVVEKEAQEQGKPL
FT                   EAHWAHMVVHGSLHLLGYDHIEDDEAEEMEALETEIMLALGYEDPYIAEKE"
     MSQVILDLQL ACEDNSGLPE ESQFQTWLNA VIPQFQEESE VTIRVVDTAE SHSLNLTYRG        60
     KDKPTNVLSF PFEVPPGMEM SLLGDLVICR QVVEKEAQEQ GKPLEAHWAH MVVHGSLHLL       120
     GYDHIEDDEA EEMEALETEI MLALGYEDPY IAEKE                                  155
//

If you have problems or comments...

PBIL Back to PBIL home page