(data stored in ACNUC7421 zone)

EMBL: CP000948.YBEZ

CP000948.YBEZ        Location/Qualifiers
FT   CDS             complement(744153..745193)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybeZ"
FT                   /locus_tag="ECDH10B_0729"
FT                   /product="predicted protein with nucleoside triphosphate
FT                   hydrolase domain"
FT                   /db_xref="EnsemblGenomes-Gn:ECDH10B_0729"
FT                   /db_xref="EnsemblGenomes-Tr:ACB01882"
FT                   /protein_id="ACB01882.1"
FT                   /translation="MNIDTREITLEPADNARLLSLCGPFDDNIKQLERRLGIEINRRDN
FT                   HFKLTGRPICVTAAADILRSLYVDTAPMRGQIQDIEPEQIHLAIKEARVLEQSAESVPE
FT                   YGKAVNIKTKRGVIKPRTPNQAQYIANILDHDITFGVGPAGTGKTYLAVAAAVDALERQ
FT                   EIRRILLTRPAVEAGEKLGFLPGDLSQKVDPYLRPLYDALFEMLGFEKVEKLIERNVIE
FT                   VAPLAYMRGRTLNDAFIILDESQNTTIEQMKMFLTRIGFNSKAVITGDVTQIDLPRNTK
FT                   SGLRHAIEVLADVEEISFNFFHSEDVVRHPVVARIVNAYEAWEEAEQKRKAALAAERKR
FT                   EEQEQK"
     MNIDTREITL EPADNARLLS LCGPFDDNIK QLERRLGIEI NRRDNHFKLT GRPICVTAAA        60
     DILRSLYVDT APMRGQIQDI EPEQIHLAIK EARVLEQSAE SVPEYGKAVN IKTKRGVIKP       120
     RTPNQAQYIA NILDHDITFG VGPAGTGKTY LAVAAAVDAL ERQEIRRILL TRPAVEAGEK       180
     LGFLPGDLSQ KVDPYLRPLY DALFEMLGFE KVEKLIERNV IEVAPLAYMR GRTLNDAFII       240
     LDESQNTTIE QMKMFLTRIG FNSKAVITGD VTQIDLPRNT KSGLRHAIEV LADVEEISFN       300
     FFHSEDVVRH PVVARIVNAY EAWEEAEQKR KAALAAERKR EEQEQK                      346
//

If you have problems or comments...

PBIL Back to PBIL home page