(data stored in ACNUC7421 zone)

EMBL: CP000948.YBFA

CP000948.YBFA        Location/Qualifiers
FT   CDS             780949..781155
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybfA"
FT                   /locus_tag="ECDH10B_0766"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECDH10B_0766"
FT                   /db_xref="EnsemblGenomes-Tr:ACB01909"
FT                   /protein_id="ACB01909.1"
FT                   /translation="MELYREYPAWLIFLRRTYAVAAGVLALPFMLFWKDRARFYSYLHR
FT                   VWSKTSDKPVWMDQAEKATGDFY"
     MELYREYPAW LIFLRRTYAV AAGVLALPFM LFWKDRARFY SYLHRVWSKT SDKPVWMDQA        60
     EKATGDFY                                                                 68
//

If you have problems or comments...

PBIL Back to PBIL home page