(data stored in ACNUC7421 zone)

EMBL: CP000948.YBFB

CP000948.YBFB        Location/Qualifiers
FT   CDS             785591..785917
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybfB"
FT                   /locus_tag="ECDH10B_0768"
FT                   /product="predicted inner membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECDH10B_0768"
FT                   /db_xref="EnsemblGenomes-Tr:ACB01911"
FT                   /protein_id="ACB01911.1"
FT                   /translation="MKYIIFLFRAIWLALSLLILFFSMHRLSLLDSTRDVSELISLMSY
FT                   GMMVICFPTGIVFFIALIFIGTVSDIIGVRIDSKYIMAIIIWLYFLSGGYIQWFVLSKR
FT                   IINK"
     MKYIIFLFRA IWLALSLLIL FFSMHRLSLL DSTRDVSELI SLMSYGMMVI CFPTGIVFFI        60
     ALIFIGTVSD IIGVRIDSKY IMAIIIWLYF LSGGYIQWFV LSKRIINK                    108
//

If you have problems or comments...

PBIL Back to PBIL home page