(data stored in ACNUC7421 zone)

EMBL: CP000948.YBFC

CP000948.YBFC        Location/Qualifiers
FT   CDS             787465..788034
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybfC"
FT                   /locus_tag="ECDH10B_0770"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECDH10B_0770"
FT                   /db_xref="EnsemblGenomes-Tr:ACB01913"
FT                   /protein_id="ACB01913.1"
FT                   /translation="MKRVLFFLLMIFVSFGVIADCEIQAKDHDCFTIFAKGTIFSAFPV
FT                   LNNKAMWRWYQNEDIGEYYWQTELGTCKNNKFTPSGARLLIRVGSLRLNENHAIKGTLQ
FT                   ELINTAEKTAFLGDRFRSYIRAGIYQKKSSDPVQLLAVLDNSIMVKYFKDEKPTYARMT
FT                   AHLPNKNESYECLIKIQHELIRSEEK"
     MKRVLFFLLM IFVSFGVIAD CEIQAKDHDC FTIFAKGTIF SAFPVLNNKA MWRWYQNEDI        60
     GEYYWQTELG TCKNNKFTPS GARLLIRVGS LRLNENHAIK GTLQELINTA EKTAFLGDRF       120
     RSYIRAGIYQ KKSSDPVQLL AVLDNSIMVK YFKDEKPTYA RMTAHLPNKN ESYECLIKIQ       180
     HELIRSEEK                                                               189
//

If you have problems or comments...

PBIL Back to PBIL home page