(data stored in ACNUC7421 zone)

EMBL: CP000948.YBFD

CP000948.YBFD        Location/Qualifiers
FT   CDS             789907..790668
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybfD"
FT                   /locus_tag="ECDH10B_0773"
FT                   /product="conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECDH10B_0773"
FT                   /db_xref="EnsemblGenomes-Tr:ACB01915"
FT                   /protein_id="ACB01915.1"
FT                   /translation="MELKKLMEHISIIPDYRQAWKVEHKLSDILLLTICAVISGAEGWE
FT                   DIEDFGETHPDFLKQYGDFENGIPVHDTIARVVSCICPAKFHESFINWMLDYHSSDDKD
FT                   VIAIDGKIHRHSYDKSRRKGAIHVISAFSTMHSLVIGQIKTDKKSNEITAIPELLNMLD
FT                   IKGKIIKTDAMGCQKDIAEKIQKQGGDYLFAVKGNQGRLNKAFEEKFPLKELNNPKHDS
FT                   YAISEKSHGREETRLHIVCDVPDELIDFTFE"
     MELKKLMEHI SIIPDYRQAW KVEHKLSDIL LLTICAVISG AEGWEDIEDF GETHPDFLKQ        60
     YGDFENGIPV HDTIARVVSC ICPAKFHESF INWMLDYHSS DDKDVIAIDG KIHRHSYDKS       120
     RRKGAIHVIS AFSTMHSLVI GQIKTDKKSN EITAIPELLN MLDIKGKIIK TDAMGCQKDI       180
     AEKIQKQGGD YLFAVKGNQG RLNKAFEEKF PLKELNNPKH DSYAISEKSH GREETRLHIV       240
     CDVPDELIDF TFE                                                          253
//

If you have problems or comments...

PBIL Back to PBIL home page