(data stored in ACNUC7421 zone)

EMBL: CP000948.YBFE

CP000948.YBFE        Location/Qualifiers
FT   CDS             complement(763420..763713)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybfE"
FT                   /locus_tag="ECDH10B_0750"
FT                   /product="LexA regulated protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECDH10B_0750"
FT                   /db_xref="EnsemblGenomes-Tr:ACB01896"
FT                   /protein_id="ACB01896.1"
FT                   /translation="MAKEQTDRTTLDLFAHERRPGRPKTNPLSRDEQLRINKRNQLKRD
FT                   KVRGLKRVELKLNAEAVEALNELAESRNMSRSELIEEMLMQQLAALRSQGIV"
     MAKEQTDRTT LDLFAHERRP GRPKTNPLSR DEQLRINKRN QLKRDKVRGL KRVELKLNAE        60
     AVEALNELAE SRNMSRSELI EEMLMQQLAA LRSQGIV                                 97
//

If you have problems or comments...

PBIL Back to PBIL home page