(data stored in ACNUC7421 zone)

EMBL: CP000948.YBFP

CP000948.YBFP        Location/Qualifiers
FT   CDS             767227..767721
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybfP"
FT                   /locus_tag="ECDH10B_0754"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECDH10B_0754"
FT                   /db_xref="EnsemblGenomes-Tr:ACB01900"
FT                   /protein_id="ACB01900.1"
FT                   /translation="MKTNRSLVVIVSLITATLLLTACAQPEQSSLAGDWLLTPKDKTRG
FT                   LTGSIAVNIAPFRCKTNCRGDNLPDNTRRWQLSGGNEKELTYLHNMSAQEKVGLNPGWQ
FT                   CYTSFFMRVCQGKPGTRPIVNEDYVSESGFFGSMMHVGIIELRRCQSENCQQELKAINT
FT                   H"
     MKTNRSLVVI VSLITATLLL TACAQPEQSS LAGDWLLTPK DKTRGLTGSI AVNIAPFRCK        60
     TNCRGDNLPD NTRRWQLSGG NEKELTYLHN MSAQEKVGLN PGWQCYTSFF MRVCQGKPGT       120
     RPIVNEDYVS ESGFFGSMMH VGIIELRRCQ SENCQQELKA INTH                        164
//

If you have problems or comments...

PBIL Back to PBIL home page