(data stored in ACNUC7421 zone)

EMBL: CP000948.YBGA

CP000948.YBGA        Location/Qualifiers
FT   CDS             790816..791325
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybgA"
FT                   /locus_tag="ECDH10B_0774"
FT                   /product="conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECDH10B_0774"
FT                   /db_xref="EnsemblGenomes-Tr:ACB01916"
FT                   /protein_id="ACB01916.1"
FT                   /translation="MNLQRFDDSTLIRIFALHELHRLKEHGLTRGALLDYHSRYKLVFL
FT                   AHSQPEYRKLGPFVADIHQWQNLDDYYNQYRQRVVVLLSHPANPRDHTNVLMHVQGYFR
FT                   PHIDSTERQQLAALIDSYRRGEQPLLAPLMRIKHYMALYPDAWLSGQRYFELWPRVINL
FT                   RHSGVL"
     MNLQRFDDST LIRIFALHEL HRLKEHGLTR GALLDYHSRY KLVFLAHSQP EYRKLGPFVA        60
     DIHQWQNLDD YYNQYRQRVV VLLSHPANPR DHTNVLMHVQ GYFRPHIDST ERQQLAALID       120
     SYRRGEQPLL APLMRIKHYM ALYPDAWLSG QRYFELWPRV INLRHSGVL                   169
//

If you have problems or comments...

PBIL Back to PBIL home page