(data stored in ACNUC7421 zone)

EMBL: CP000948.YBGD

CP000948.YBGD        Location/Qualifiers
FT   CDS             complement(804044..804610)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybgD"
FT                   /locus_tag="ECDH10B_0786"
FT                   /product="predicted fimbrial-like adhesin protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECDH10B_0786"
FT                   /db_xref="EnsemblGenomes-Tr:ACB01928"
FT                   /protein_id="ACB01928.1"
FT                   /translation="MFKGQKTLAALAVSLLFTAPVYAADEGSGEIHFKGEVIEAPCEIH
FT                   PEDIDKNIDLGQVTTTHINREHHSNKVAVDIRLINCDLPASDNGSGMPVSKVGVTFDST
FT                   AKTTGATPLLSNTSAGEATGVGVRLMDKNDGNIVLGSAAPDLDLDASSSEQTLNFFAWM
FT                   EQIDNAVDVTAGEVTANATYVLDYK"
     MFKGQKTLAA LAVSLLFTAP VYAADEGSGE IHFKGEVIEA PCEIHPEDID KNIDLGQVTT        60
     THINREHHSN KVAVDIRLIN CDLPASDNGS GMPVSKVGVT FDSTAKTTGA TPLLSNTSAG       120
     EATGVGVRLM DKNDGNIVLG SAAPDLDLDA SSSEQTLNFF AWMEQIDNAV DVTAGEVTAN       180
     ATYVLDYK                                                                188
//

If you have problems or comments...

PBIL Back to PBIL home page