(data stored in ACNUC7421 zone)

EMBL: CP000948.YBGK

CP000948.YBGK        Location/Qualifiers
FT   CDS             796058..796990
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybgK"
FT                   /locus_tag="ECDH10B_0779"
FT                   /product="predicted enzyme subunit"
FT                   /db_xref="EnsemblGenomes-Gn:ECDH10B_0779"
FT                   /db_xref="EnsemblGenomes-Tr:ACB01921"
FT                   /protein_id="ACB01921.1"
FT                   /translation="MLKIIRAGMYTTVQDGGRHGFRQSGISHCGALDMPALRIANLLVG
FT                   NDANAPALEITLGQLTVEFETDGWFALTGAGCEARLDDNAVWTGWRLPMKAGQRLTLKR
FT                   PQHGMRSYLAVAGGIDVPPVMGSCSTDLKVGIGGLEGRLLKDGDRLPIGKSKRDSMEAQ
FT                   GVKQLLWGNRIRALPGPEYHEFDRASQDAFWRSPWQLSSQSNRMGYRLQGQILKRTTDR
FT                   ELLSHGLLPGVVQVPHNGQPIVLMNDAQTTGGYPRIACIIEADMYHLAQIPLGQPIHFV
FT                   QCSLEEALKARQDQQRYFEQLAWRLHNEN"
     MLKIIRAGMY TTVQDGGRHG FRQSGISHCG ALDMPALRIA NLLVGNDANA PALEITLGQL        60
     TVEFETDGWF ALTGAGCEAR LDDNAVWTGW RLPMKAGQRL TLKRPQHGMR SYLAVAGGID       120
     VPPVMGSCST DLKVGIGGLE GRLLKDGDRL PIGKSKRDSM EAQGVKQLLW GNRIRALPGP       180
     EYHEFDRASQ DAFWRSPWQL SSQSNRMGYR LQGQILKRTT DRELLSHGLL PGVVQVPHNG       240
     QPIVLMNDAQ TTGGYPRIAC IIEADMYHLA QIPLGQPIHF VQCSLEEALK ARQDQQRYFE       300
     QLAWRLHNEN                                                              310
//

If you have problems or comments...

PBIL Back to PBIL home page