(data stored in ACNUC7421 zone)

EMBL: CP000948.YBGL

CP000948.YBGL        Location/Qualifiers
FT   CDS             796980..797714
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybgL"
FT                   /locus_tag="ECDH10B_0780"
FT                   /product="predicted lactam utilization protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECDH10B_0780"
FT                   /db_xref="EnsemblGenomes-Tr:ACB01922"
FT                   /db_xref="GOA:B1X6P4"
FT                   /db_xref="InterPro:IPR005501"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="UniProtKB/Swiss-Prot:B1X6P4"
FT                   /protein_id="ACB01922.1"
FT                   /translation="MKIDLNADLGEGCASDAELLTLVSSANIACGFHAGDAQIMQACVR
FT                   EAIKNGVAIGAHPSFPDRENFGRSAMQLPPETVYAQTLYQIGALATIARAQGGVMRHVK
FT                   PHGMLYNQAAKEAQLADAIARAVYACDPALILVGLAGSELIRAGKQYGLTTREEVFADR
FT                   GYQADGSLVPRSQSGALIENEEQALAQTLEMVQHGRVKSITGEWATVAAQTVCLHGDGE
FT                   HALAFARRLRSAFAEKGIVVAA"
     MKIDLNADLG EGCASDAELL TLVSSANIAC GFHAGDAQIM QACVREAIKN GVAIGAHPSF        60
     PDRENFGRSA MQLPPETVYA QTLYQIGALA TIARAQGGVM RHVKPHGMLY NQAAKEAQLA       120
     DAIARAVYAC DPALILVGLA GSELIRAGKQ YGLTTREEVF ADRGYQADGS LVPRSQSGAL       180
     IENEEQALAQ TLEMVQHGRV KSITGEWATV AAQTVCLHGD GEHALAFARR LRSAFAEKGI       240
     VVAA                                                                    244
//

If you have problems or comments...

PBIL Back to PBIL home page