(data stored in ACNUC7421 zone)

EMBL: CP000948.YBGO

CP000948.YBGO        Location/Qualifiers
FT   CDS             complement(799736..800797)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybgO"
FT                   /locus_tag="ECDH10B_0783"
FT                   /product="predicted fimbrial-like adhesin protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECDH10B_0783"
FT                   /db_xref="EnsemblGenomes-Tr:ACB01925"
FT                   /protein_id="ACB01925.1"
FT                   /translation="MSAGKGLLLVICLLFLPLKSAMALNCYFGTSGGAVEKSEAIQPFA
FT                   VPGNAKPGDKIWESDDIKIPVYCDNNTNGNFESEHVYAWVNPYPGVQDRYYQLGVTYNG
FT                   VDYDASLGKSRIDTNQCIDSKNIDIYTPEQIIAMGWQNKICSGDPANIHMSRTFLARMR
FT                   LYVKIREMPPHDYQSTLSDYIVVQFDGAGSVNEDPTAQNLKYHITGLENIRVLDCSVNF
FT                   SISPETQVIDFGKFNLLDIRRHTMSKTFSIKTTKSQNDQCTDGFKVSSSFYTEETLVEE
FT                   DKALLIGNGLKLRLLDENASPYTFNKYAEYADFTSDMLVYEKTYTAELSSIPGTPIEAG
FT                   PFDTVVLFKINYN"
     MSAGKGLLLV ICLLFLPLKS AMALNCYFGT SGGAVEKSEA IQPFAVPGNA KPGDKIWESD        60
     DIKIPVYCDN NTNGNFESEH VYAWVNPYPG VQDRYYQLGV TYNGVDYDAS LGKSRIDTNQ       120
     CIDSKNIDIY TPEQIIAMGW QNKICSGDPA NIHMSRTFLA RMRLYVKIRE MPPHDYQSTL       180
     SDYIVVQFDG AGSVNEDPTA QNLKYHITGL ENIRVLDCSV NFSISPETQV IDFGKFNLLD       240
     IRRHTMSKTF SIKTTKSQND QCTDGFKVSS SFYTEETLVE EDKALLIGNG LKLRLLDENA       300
     SPYTFNKYAE YADFTSDMLV YEKTYTAELS SIPGTPIEAG PFDTVVLFKI NYN              353
//

If you have problems or comments...

PBIL Back to PBIL home page