(data stored in ACNUC7421 zone)

EMBL: CP000948.YBGQ

CP000948.YBGQ        Location/Qualifiers
FT   CDS             complement(801537..803984)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybgQ"
FT                   /locus_tag="ECDH10B_0785"
FT                   /product="predicted outer membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECDH10B_0785"
FT                   /db_xref="EnsemblGenomes-Tr:ACB01927"
FT                   /protein_id="ACB01927.1"
FT                   /translation="MNIYRLSFVSCLVMAMPCAMAVEFNLNVLDKSMRDRIDISLLKEK
FT                   GVIAPGEYFVSVAVNNNKISNGQKINWQKKGDKTIPCINDSLVDKFGLKPDIRQSLPQI
FT                   DRCIDFSSRPEMLFNFDQANQQLNISIPQAWLAWHSENWAPPSTWKEGVAGVLMDYNLF
FT                   ASSYRPQDGSSSTNLNAYGTAGINAGAWRLRSDYQLNKTDSEDNHDQSGGISRTYLFRP
FT                   LPQLGSKLTLGETDFSSNIFDGFSYTGAALASDDRMLPWELRGYAPQISGIAQTNATVT
FT                   ISQSGRVIYQKKVPPGPFIIDDLNQSVQGTLDVKVTEEDGRVNNFQVSAASTPFLTRQG
FT                   QVRYKLAAGQPRPSMSHQTENETFFSNEVSWGMLSNTSLYGGLLISDDDYHSAAMGIGQ
FT                   NMLWLGALSFDVTWASSHFDTQQDERGLSYRFNYSKQVDATNSTISLAAYRFSDRHFHS
FT                   YANYLDHKYNDSDAQDEKQTISLSVGQPITPLNLNLYANLLHQTWWNADASTTANITAG
FT                   FNVDIGDWRDISISTSFNTTHYEDKDRDNQIYLSISLPFGNGGRVGYDMQNSSHSTIHR
FT                   MSWNDTLDERNSWGMSAGLQSDRPDNGAQVSGNYQHLSSAGEWDISGTYAASDYSSVSS
FT                   SWSGSFTATQYGAAFHRRSSTNEPRLMVSTDGVADIPVQGNLDYTNHFGIAVVPLISSY
FT                   QPSTVAVNMNDLPDGVTVAENVIKETWIEGAIGYKSLASRSGKDVNVIIRNASGQFPPL
FT                   GADIRQDDSGISVGMVGEEGHAWLSGVAENQLFTVVWGEQSCIIHLPERLEDTTKRLIL
FT                   PCH"
     MNIYRLSFVS CLVMAMPCAM AVEFNLNVLD KSMRDRIDIS LLKEKGVIAP GEYFVSVAVN        60
     NNKISNGQKI NWQKKGDKTI PCINDSLVDK FGLKPDIRQS LPQIDRCIDF SSRPEMLFNF       120
     DQANQQLNIS IPQAWLAWHS ENWAPPSTWK EGVAGVLMDY NLFASSYRPQ DGSSSTNLNA       180
     YGTAGINAGA WRLRSDYQLN KTDSEDNHDQ SGGISRTYLF RPLPQLGSKL TLGETDFSSN       240
     IFDGFSYTGA ALASDDRMLP WELRGYAPQI SGIAQTNATV TISQSGRVIY QKKVPPGPFI       300
     IDDLNQSVQG TLDVKVTEED GRVNNFQVSA ASTPFLTRQG QVRYKLAAGQ PRPSMSHQTE       360
     NETFFSNEVS WGMLSNTSLY GGLLISDDDY HSAAMGIGQN MLWLGALSFD VTWASSHFDT       420
     QQDERGLSYR FNYSKQVDAT NSTISLAAYR FSDRHFHSYA NYLDHKYNDS DAQDEKQTIS       480
     LSVGQPITPL NLNLYANLLH QTWWNADAST TANITAGFNV DIGDWRDISI STSFNTTHYE       540
     DKDRDNQIYL SISLPFGNGG RVGYDMQNSS HSTIHRMSWN DTLDERNSWG MSAGLQSDRP       600
     DNGAQVSGNY QHLSSAGEWD ISGTYAASDY SSVSSSWSGS FTATQYGAAF HRRSSTNEPR       660
     LMVSTDGVAD IPVQGNLDYT NHFGIAVVPL ISSYQPSTVA VNMNDLPDGV TVAENVIKET       720
     WIEGAIGYKS LASRSGKDVN VIIRNASGQF PPLGADIRQD DSGISVGMVG EEGHAWLSGV       780
     AENQLFTVVW GEQSCIIHLP ERLEDTTKRL ILPCH                                  815
//

If you have problems or comments...

PBIL Back to PBIL home page