(data stored in ACNUC7421 zone)

EMBL: CP000948.YKFA

CP000948.YKFA        Location/Qualifiers
FT   CDS             complement(241425..242288)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ykfA"
FT                   /locus_tag="ECDH10B_0238"
FT                   /product="CP4-6 prophage; predicted GTP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECDH10B_0238"
FT                   /db_xref="EnsemblGenomes-Tr:ACB01420"
FT                   /protein_id="ACB01420.1"
FT                   /translation="MNNSEGLKSFQQSLADLPQWVSERLLQQINQLTNYEPVIGIMGKT
FT                   GVGKSSLCNALFAGDISPVSDVAACTREPLRFRLQVGDRYITLMDLPGVGESGARDTEY
FT                   AALYREQLPRLDLVLWLIKADDRALTVDEHFYHQVIGEVYRHKVLFVISQSDKAEPTSG
FT                   GGQLSTAQKQNISRKICLLHELFQPVHPVCAVSVRLQWGLKVMAERMIKCLPREATSPV
FT                   VSQLHPSFRTTVVREQARSDFGETVGAVLDSISAFPLIPAPVRAVIQAVRTTVVSVARA
FT                   VWDFFF"
     MNNSEGLKSF QQSLADLPQW VSERLLQQIN QLTNYEPVIG IMGKTGVGKS SLCNALFAGD        60
     ISPVSDVAAC TREPLRFRLQ VGDRYITLMD LPGVGESGAR DTEYAALYRE QLPRLDLVLW       120
     LIKADDRALT VDEHFYHQVI GEVYRHKVLF VISQSDKAEP TSGGGQLSTA QKQNISRKIC       180
     LLHELFQPVH PVCAVSVRLQ WGLKVMAERM IKCLPREATS PVVSQLHPSF RTTVVREQAR       240
     SDFGETVGAV LDSISAFPLI PAPVRAVIQA VRTTVVSVAR AVWDFFF                     287
//

If you have problems or comments...

PBIL Back to PBIL home page