(data stored in ACNUC7421 zone)

EMBL: CP000948.YKFB

CP000948.YKFB        Location/Qualifiers
FT   CDS             complement(238948..239415)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ykfB"
FT                   /locus_tag="ECDH10B_0233"
FT                   /product="CP4-6 prophage; predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECDH10B_0233"
FT                   /db_xref="EnsemblGenomes-Tr:ACB01417"
FT                   /protein_id="ACB01417.1"
FT                   /translation="MTILSLSRFMLAGVLLASFNASAIPGFWQQGYGQGNTEYSVTEAS
FT                   GKTFTINCTGNPDQNGFYQHSVFLTLADDKMVSSHDDDTTITVVMDHQQYIIPSSLGWR
FT                   NGDNAWFDFISNISEAGQFDVYVNDHKAGTFTADRKNAEKVLSTLGDCSND"
     MTILSLSRFM LAGVLLASFN ASAIPGFWQQ GYGQGNTEYS VTEASGKTFT INCTGNPDQN        60
     GFYQHSVFLT LADDKMVSSH DDDTTITVVM DHQQYIIPSS LGWRNGDNAW FDFISNISEA       120
     GQFDVYVNDH KAGTFTADRK NAEKVLSTLG DCSND                                  155
//

If you have problems or comments...

PBIL Back to PBIL home page