(data stored in ACNUC7421 zone)

EMBL: CP000948.YKFF

CP000948.YKFF        Location/Qualifiers
FT   CDS             complement(238632..238871)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ykfF"
FT                   /locus_tag="ECDH10B_0232"
FT                   /product="CP4-6 prophage; predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECDH10B_0232"
FT                   /db_xref="EnsemblGenomes-Tr:ACB01416"
FT                   /protein_id="ACB01416.1"
FT                   /translation="MTQSVLLPPGPFTRRQAQAVTTTYSNITLEDDQGSHFRLVVRDTE
FT                   GRMVWRAWNFEPDAGEGLNRYIRTSGIRTDTATR"
     MTQSVLLPPG PFTRRQAQAV TTTYSNITLE DDQGSHFRLV VRDTEGRMVW RAWNFEPDAG        60
     EGLNRYIRTS GIRTDTATR                                                     79
//

If you have problems or comments...

PBIL Back to PBIL home page