(data stored in ACNUC7421 zone)

EMBL: CP000948.YKFG

CP000948.YKFG        Location/Qualifiers
FT   CDS             complement(237584..238060)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ykfG"
FT                   /locus_tag="ECDH10B_0230"
FT                   /product="CP4-6 prophage; predicted DNA repair protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECDH10B_0230"
FT                   /db_xref="EnsemblGenomes-Tr:ACB01414"
FT                   /protein_id="ACB01414.1"
FT                   /translation="MKQLSFLPGEMTPQDRRLIQRALRALDRHLHEPGVAFTSTHAVRE
FT                   WLRLHMAALEREEFRVLYLDNQNQLIAHETLFTGTINRTEVHPREVVKRALHFNAAAVI
FT                   LAHNHPSGETTPSQADKTLTQRLVQVLQLVDIRVPDHLIVGGRQIYSFAEHGLL"
     MKQLSFLPGE MTPQDRRLIQ RALRALDRHL HEPGVAFTST HAVREWLRLH MAALEREEFR        60
     VLYLDNQNQL IAHETLFTGT INRTEVHPRE VVKRALHFNA AAVILAHNHP SGETTPSQAD       120
     KTLTQRLVQV LQLVDIRVPD HLIVGGRQIY SFAEHGLL                               158
//

If you have problems or comments...

PBIL Back to PBIL home page