(data stored in ACNUC7421 zone)

EMBL: CP000948.YKGI

CP000948.YKGI        Location/Qualifiers
FT   CDS             complement(293105..293341)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ykgI"
FT                   /locus_tag="ECDH10B_0291"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECDH10B_0291"
FT                   /db_xref="EnsemblGenomes-Tr:ACB01469"
FT                   /protein_id="ACB01469.1"
FT                   /translation="MFKKSVLFATLLSGVMAFSTNADDKIILKHISVSSVSASPTVLED
FT                   TIADIARKYNASSWKVTSMRIDNNSTATAVLYK"
     MFKKSVLFAT LLSGVMAFST NADDKIILKH ISVSSVSASP TVLEDTIADI ARKYNASSWK        60
     VTSMRIDNNS TATAVLYK                                                      78
//

If you have problems or comments...

PBIL Back to PBIL home page