(data stored in ACNUC7421 zone)

EMBL: CP000948.YKGL

CP000948.YKGL        Location/Qualifiers
FT   CDS             286886..287113
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ykgL"
FT                   /locus_tag="ECDH10B_0283"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECDH10B_0283"
FT                   /db_xref="EnsemblGenomes-Tr:ACB01461"
FT                   /protein_id="ACB01461.1"
FT                   /translation="MQAAPQREETEWRVQSKRGLMPAYRGEAGQQVNIKIMEYSERNVR
FT                   QLASNEQEEYIPRKINVGVINTPTLIRSDY"
     MQAAPQREET EWRVQSKRGL MPAYRGEAGQ QVNIKIMEYS ERNVRQLASN EQEEYIPRKI        60
     NVGVINTPTL IRSDY                                                         75
//

If you have problems or comments...

PBIL Back to PBIL home page