(data stored in ACNUC7421 zone)

EMBL: CP000948.YKGN

CP000948.YKGN        Location/Qualifiers
FT   CDS             complement(253352..253690)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ykgN"
FT                   /locus_tag="ECDH10B_0252"
FT                   /product="predicted IS protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECDH10B_0252"
FT                   /db_xref="EnsemblGenomes-Tr:ACB01432"
FT                   /protein_id="ACB01432.1"
FT                   /translation="MSGKRYPEEFKTEAVKQVVDLGYSVASVATRLDITTHSLYAWIKK
FT                   YGPDSSTNKEQSDAQAEIRRLQKELKRVTDERDILKKAAVDSICQCNTPFNYLFRCFEL
FT                   QCLSRSVV"
     MSGKRYPEEF KTEAVKQVVD LGYSVASVAT RLDITTHSLY AWIKKYGPDS STNKEQSDAQ        60
     AEIRRLQKEL KRVTDERDIL KKAAVDSICQ CNTPFNYLFR CFELQCLSRS VV               112
//

If you have problems or comments...

PBIL Back to PBIL home page