(data stored in ACNUC7421 zone)

EMBL: CP000948.YKIA

CP000948.YKIA        Location/Qualifiers
FT   CDS             347224..347505
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ykiA"
FT                   /locus_tag="ECDH10B_0349"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECDH10B_0349"
FT                   /db_xref="EnsemblGenomes-Tr:ACB01521"
FT                   /protein_id="ACB01521.1"
FT                   /translation="MLQSRNDHLRQTALRNAHTPALLLTTLTEPQDRSLAINNPQLAAD
FT                   VKTAWLKEDPSLLLFVEQPDLSLLRDLVKTGATRKIRSEARHRLEEKQ"
     MLQSRNDHLR QTALRNAHTP ALLLTTLTEP QDRSLAINNP QLAADVKTAW LKEDPSLLLF        60
     VEQPDLSLLR DLVKTGATRK IRSEARHRLE EKQ                                     93
//

If you have problems or comments...

PBIL Back to PBIL home page