(data stored in ACNUC7421 zone)

EMBL: CP000948.YKIB

CP000948.YKIB        Location/Qualifiers
FT   CDS             complement(328452..328721)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ykiB"
FT                   /locus_tag="ECDH10B_0326"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECDH10B_0326"
FT                   /db_xref="EnsemblGenomes-Tr:ACB01501"
FT                   /protein_id="ACB01501.1"
FT                   /translation="MLRYRRMVQLFFPLSPNVDIYNLWRKTRIKFIKAQYFNMLQIILF
FT                   LKHTHNKYHKHKPDKYPMNMQQSFNYSIYSSATKLQKIITNSYK"
     MLRYRRMVQL FFPLSPNVDI YNLWRKTRIK FIKAQYFNML QIILFLKHTH NKYHKHKPDK        60
     YPMNMQQSFN YSIYSSATKL QKIITNSYK                                          89
//

If you have problems or comments...

PBIL Back to PBIL home page