(data stored in ACNUC7421 zone)

EMBL: CP000948.YLAC

CP000948.YLAC        Location/Qualifiers
FT   CDS             complement(417336..417806)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ylaC"
FT                   /locus_tag="ECDH10B_0414"
FT                   /product="predicted inner membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECDH10B_0414"
FT                   /db_xref="EnsemblGenomes-Tr:ACB01585"
FT                   /protein_id="ACB01585.1"
FT                   /translation="MTEIQRLLTETIESLNTREKRDNKPRFSISFIRKHPGLFIGMYVA
FT                   FFATLAVMLQSETLSGSVWLLVVLFILLNGFFFFDVYPRYRYEDIDVLDFRVCYNGEWY
FT                   NTRFVPAALVEAILNSPRVADVHKEQLQKMIVRKGELSFYDIFTLARAESTS"
     MTEIQRLLTE TIESLNTREK RDNKPRFSIS FIRKHPGLFI GMYVAFFATL AVMLQSETLS        60
     GSVWLLVVLF ILLNGFFFFD VYPRYRYEDI DVLDFRVCYN GEWYNTRFVP AALVEAILNS       120
     PRVADVHKEQ LQKMIVRKGE LSFYDIFTLA RAESTS                                 156
//

If you have problems or comments...

PBIL Back to PBIL home page